PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A11G1005
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 384aa    MW: 43451.3 Da    PI: 4.4685
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A11G1005genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.52.8e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +grWT+eEde+l ++++ +G g+W++ ++  g+ R++k+c++rw +yl
      Gh_A11G1005 14 KGRWTAEEDEILTKYIQTHGEGSWRSLPKNAGLLRCGKSCRLRWANYL 61
                     79******************************99************97 PP

2Myb_DNA-binding58.41.7e-1867112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T eEdel++++++ lG++ W++Ia++++ gRt++++k++w+++l
      Gh_A11G1005  67 RGNFTGEEDELIIKLHQSLGNR-WSLIASHLP-GRTDNEIKNYWNSHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.7E-23564IPR009057Homeodomain-like
PROSITE profilePS5129415.812961IPR017930Myb domain
SuperFamilySSF466893.23E-3011108IPR009057Homeodomain-like
SMARTSM007176.2E-131363IPR001005SANT/Myb domain
PfamPF002493.6E-151461IPR001005SANT/Myb domain
CDDcd001678.78E-101661No hitNo description
PROSITE profilePS5129426.28862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.5E-2765116IPR009057Homeodomain-like
SMARTSM007174.1E-1866114IPR001005SANT/Myb domain
PfamPF002491.1E-1667112IPR001005SANT/Myb domain
CDDcd001678.17E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MGRAPCCEKV GLKKGRWTAE EDEILTKYIQ THGEGSWRSL PKNAGLLRCG KSCRLRWANY  60
LRADLKRGNF TGEEDELIIK LHQSLGNRWS LIASHLPGRT DNEIKNYWNS HLSTKMYCFR  120
RLSNQSLPVI LNVTERKGGR KGMKDNQGHS TKKENNGNSS SNKPMEVFID EVVPFPSTPS  180
LEKETFPSAV EDSMHLDPYE EDNERRIGVM PGSCQHTGDG DGYVENSMLC PTATVSVVEK  240
ETDIFSLFES NESSGMLCFD NILDNELLQT NGDSTLSQWG LNQVSVDLEN SGDLCPNRPA  300
AINKQVESGD CGTGDLTTYF CTTSCFFDDC EVENILDWDW ERNELWDEKE CIMPSWLWEL  360
DYNDKDDRLT LENNDLELHG SAVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-25121162105C-Myb DNA-Binding Domain
1msf_C2e-25121162105C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012490341.10.0PREDICTED: transcription factor MYB12-like
TrEMBLA0A0D2QRE20.0A0A0D2QRE2_G
STRINGPOPTR_0002s19920.19e-92(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17349511
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49330.12e-72myb domain protein 111